Trim21 Recombinant Protein, Mouse

Product Overview

• Article Name: Trim21 Recombinant Protein, Mouse
• Biozol Catalog Number: ASB-OPCA02306
• Supplier Catalog Number: OPCA02306
• Alternative Catalog Number: ASB-OPCA02306-100UG,ASB-OPCA02306-1MG,ASB-OPCA02306-20UG
• Manufacturer: Aviva
• Host: Mouse
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Alternative Names: 52 kDa ribonucleoprotein autoantigen Ro/SS-A,52 kDa Ro protein,RING-type E3 ubiquitin transferase TRIM21,Ro(SS-A),Sjoegren syndrome type A antigen,Tripartite motif-containing protein 21.

Product Description

E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its s

Product Properties

• Molecular Weight: 70.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: Q62191
• Source: E.coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
• Sequence: Full Length: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELIS