LARP1B Recombinant Protein, Human

Catalog Number: ASB-OPCA02307
Article Name: LARP1B Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02307
Supplier Catalog Number: OPCA02307
Alternative Catalog Number: ASB-OPCA02307-100UG,ASB-OPCA02307-1MG,ASB-OPCA02307-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: La ribonucleoprotein domain family member 1B,La ribonucleoprotein domain family member 2,La ribonucleoprotein domain family, member 2,la-related protein 1B,la-related protein 2,LARP2.
This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif
Molecular Weight: 40.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 55132
UniProt: Q659C4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE