ATG16L1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02308
Article Name: ATG16L1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02308
Supplier Catalog Number: OPCA02308
Alternative Catalog Number: ASB-OPCA02308-100UG,ASB-OPCA02308-1MG,ASB-OPCA02308-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: APG16L,APG16L beta,APG16-like 1,ATG16 autophagy related 16-like 1,ATG16A,ATG16L,autophagy-related protein 16-1,IBD10,WD repeat domain 30,WDR30.
Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elo
Molecular Weight: 84.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 55054
UniProt: Q676U5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEET