DUSP13 Recombinant Protein, Human

Catalog Number: ASB-OPCA02309
Article Name: DUSP13 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02309
Supplier Catalog Number: OPCA02309
Alternative Catalog Number: ASB-OPCA02309-100UG,ASB-OPCA02309-1MG,ASB-OPCA02309-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: BEDP,branching-enzyme interacting DSP,branching-enzyme interacting dual-specificity protein phosphatase,dual specificity protein phosphatase 13,DUSP13A,DUSP13B,MDSP,muscle-restricted DSP,SKRP4,testis- and skeletal-muscle-specific DSP,TMDP.
Probable protein tyrosine phosphatase. Has phosphatase activity with synthetic substrates (PubMed:15252030, PubMed:29106959). Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by A
Molecular Weight: 36.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 51207
UniProt: Q6B8I1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS