CIAPIN1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02310
Article Name: CIAPIN1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02310
Supplier Catalog Number: OPCA02310
Alternative Catalog Number: ASB-OPCA02310-100UG,ASB-OPCA02310-1MG,ASB-OPCA02310-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: anamorsin,CIAE2,Cytokine-induced apoptosis inhibitor 1,DRE2,fe-S cluster assembly protein DRE2 homolog,predicted protein of HQ0915,PRO0915.
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the
Molecular Weight: 49.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 57019
UniProt: Q6FI81
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLA