TMPRSS2 Recombinant Protein, Yeast

Product Overview

• Article Name: TMPRSS2 Recombinant Protein, Yeast
• Biozol Catalog Number: ASB-OPCA03288
• Supplier Catalog Number: OPCA03288
• Alternative Catalog Number: ASB-OPCA03288-100UG,ASB-OPCA03288-20UG,ASB-OPCA03288-500UG
• Manufacturer: Aviva
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: epitheliasin,PRSS10,serine protease 10,transmembrane protease serine 2,transmembrane protease, serine 2.

Product Description

Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions, spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refo

Product Properties

• Molecular Weight: 44.8 kDa
• Tag: N-terminal 6xHis-tagged
• NCBI: 7113
• UniProt: O15393
• Source: Yeast
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: Partial Protein (106-492aa): WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYG