ACE2 Recombinant Protein

Product Overview

• Article Name: ACE2 Recombinant Protein
• Biozol Catalog Number: ASB-OPCA335977
• Supplier Catalog Number: OPCA335977
• Alternative Catalog Number: ASB-OPCA335977-10UG,ASB-OPCA335977-1MG,ASB-OPCA335977-500UG,ASB-OPCA335977-50UG
• Manufacturer: Aviva
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Human
• Alternative Names: ACEH,ACE-related carboxypeptidase,angiotensin I converting enzyme (peptidyl-dipeptidase A) 2,angiotensin I converting enzyme 2,angiotensin-converting enzyme 2,angiotensin-converting enzyme homolog,angiotensin-converting enzyme-related carboxypeptidase,me

Product Description

Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin

Product Properties

• Molecular Weight: 84.63 kDa
• Tag: C-terminal 6xHis-tagged
• NCBI: 59272
• UniProt: Q9BYF1
• Buffer: 0.2 um Filtered 20 mM Tris, 300 mM NaCl, 1 mM ZnCl2, 10% Glycerol, pH 7.4
• Source: Mammalian Cells
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Liquid
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMW

Images

OPCA335977