Recombinant SARS-CoV-2 Spike Glycoprotein

Catalog Number: ASB-OPCA335982
Article Name: Recombinant SARS-CoV-2 Spike Glycoprotein
Biozol Catalog Number: ASB-OPCA335982
Supplier Catalog Number: OPCA335982
Alternative Catalog Number: ASB-OPCA335982-100UG,ASB-OPCA335982-1MG,ASB-OPCA335982-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Virus
Alternative Names: E2,GU280_gp02,Peplomer protein,spike glycoprotein,surface glycoprotein., sars-cov-2
Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycopro
Molecular Weight: 79.6 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged
NCBI: 43740568
UniProt: P0DTC2
Source: Mammalian Cells
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: Partial Protein: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALH
OPCA335982