ACE2 Recombinant Protein

Product Overview

• Article Name: ACE2 Recombinant Protein
• Biozol Catalog Number: ASB-OPCA335985
• Supplier Catalog Number: OPCA335985
• Alternative Catalog Number: ASB-OPCA335985-100UG,ASB-OPCA335985-20UG,ASB-OPCA335985-500UG
• Manufacturer: Aviva
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: ACEH,ACE-related carboxypeptidase,angiotensin I converting enzyme (peptidyl-dipeptidase A) 2,angiotensin I converting enzyme 2,angiotensin-converting enzyme 2,angiotensin-converting enzyme homolog,angiotensin-converting enzyme-related carboxypeptidase,me

Product Description

Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin

Product Properties

• Molecular Weight: 112.5 kDa
• Tag: C-terminal hFc-tagged
• NCBI: 59272
• UniProt: Q9BYF1
• Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: Mammalian Cells
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMW

Images

OPCA335985