Anti-SOX11, IgG2a, Clone: [CL0143], Mouse, Monoclonal

Product Overview

• Article Name: Anti-SOX11, IgG2a, Clone: [CL0143], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90502
• Supplier Catalog Number: AMAb90502
• Alternative Catalog Number: ATA-AMAB90502-100,ATA-AMAB90502-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

SRY (sex determining region Y)-box 11

Additional Information

Anti-SOX11

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL0143]
• Isotype: IgG2a
• NCBI: 6664
• UniProt: P35716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SOX11
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemical staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.

Immunohistochemical staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.

Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: SOX11 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418895)

AMAb90502

AMAb90502

AMAb90502