Anti-CD45, IgG2a, Clone: [CL0160], Mouse, Monoclonal

Product Overview

• Article Name: Anti-CD45, IgG2a, Clone: [CL0160], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90519
• Supplier Catalog Number: AMAb90519
• Alternative Catalog Number: ATA-AMAB90519-100,ATA-AMAB90519-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PTPRC, GP180, LCA, T200, Pan-Cancer

Product Description

protein tyrosine phosphatase, receptor type C

Additional Information

Anti-CD45

Product Properties

• Clonality: Monoclonal
• Concentration: 0.8
• Clone Designation: [CL0160]
• Isotype: IgG2a
• NCBI: 5788
• UniProt: P08575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PTPRC
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 1 µg/ml

Images

Immunohistochemical staining of human tonsil shows strong positivity in a majority of lymphoid cells

Immunohistochemical staining of human appendix shows strong positivity in lymphoid cells but no positivity in glandular cells.

Lane 1: Marker [kDa]
Lane 2: Human cell line Jurkat
Lane 3: Human cell line MCF-7

AMAb90519

AMAb90519

AMAb90519