Anti-CHGA, IgG1, Clone: [CL0166], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90525
- Images (9)
| Article Name: | Anti-CHGA, IgG1, Clone: [CL0166], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90525 |
| Supplier Catalog Number: | AMAb90525 |
| Alternative Catalog Number: | ATA-AMAB90525-100,ATA-AMAB90525-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| chromogranin A (parathyroid secretory protein 1) |
| Anti-CHGA |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0166] |
| Isotype: | IgG1 |
| NCBI: | 1113 |
| UniProt: | P10645 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHGA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in endocrine islets of Langerhans. |
|
|
Immunohistochemical staining of human colon shows strong reactivity in a subset of enteroendocrine cells. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in a subset of enteroendocrine cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: CHGA Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400511) |
|
|
AMAb90525 |
|
|
|
|
|
|
|
|
AMAb90525 |
|
|
AMAb90525 |
Product Guarantee and Expert Support
