Anti-STX7, IgG1, Clone: [CL0257], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90616
Article Name: |
Anti-STX7, IgG1, Clone: [CL0257], Mouse, Monoclonal |
Biozol Catalog Number: |
ATA-AMAB90616 |
Supplier Catalog Number: |
AMAb90616 |
Alternative Catalog Number: |
ATA-AMAB90616-100,ATA-AMAB90616-25 |
Manufacturer: |
Atlas Antibodies |
Host: |
Mouse |
Category: |
Antikörper |
Application: |
ICC, IHC, WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
STX7 |
Clonality: |
Monoclonal |
Concentration: |
1 |
Clone Designation: |
[CL0257] |
Isotype: |
IgG1 |
NCBI: |
8417 |
UniProt: |
O15400 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Protein A purified |
Sequence: |
GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
STX7 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human melanoma shows strong cytoplasmic and membrane positivity in tumour cells. |
|
Immunohistochemical staining of human melanoma shows strong cytoplasmic positivity in tumour cells. |
|
Immunohistochemical staining of human lymph node shows strong membrane positivity in non-germinal center cells. |
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
AMAb90616 |
|
|
|
|
|
AMAb90616 |
|
AMAb90616 |