Anti-CA12, IgG2a, Clone: [CL0278], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90637
- Images (9)
| Article Name: | Anti-CA12, IgG2a, Clone: [CL0278], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90637 |
| Supplier Catalog Number: | AMAb90637 |
| Alternative Catalog Number: | ATA-AMAB90637-100,ATA-AMAB90637-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HsT18816 |
| carbonic anhydrase XII |
| Anti-CA12 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0278] |
| Isotype: | IgG2a |
| NCBI: | 771 |
| UniProt: | O43570 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CA12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules, but not glomeruli. |
|
|
Immunohistochemical staining of human rectum shows strong membranous positivity in glandular epithelial cells. |
|
|
Immunohistochemical staining of human stomach shows moderate membranous immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
|
AMAb90637 |
|
|
|
|
|
AMAb90637 |
|
|
AMAb90637 |
Product Guarantee and Expert Support
