Anti-CA12, IgG1, Clone: [CL0280], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90639
- Images (9)
| Article Name: | Anti-CA12, IgG1, Clone: [CL0280], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90639 |
| Supplier Catalog Number: | AMAb90639 |
| Alternative Catalog Number: | ATA-AMAB90639-100,ATA-AMAB90639-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HsT18816 |
| carbonic anhydrase XII |
| Anti-CA12 |
| Clonality: | Monoclonal |
| Concentration: | 0.7 |
| Clone Designation: | [CL0280] |
| Isotype: | IgG1 |
| NCBI: | 771 |
| UniProt: | O43570 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CA12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong membranous and/or moderate cytoplasmic immunoreactivity in subsets of renal tubules, while glomeruli are negative. |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows strong membranous and moderate cytopalsmic positivity in the exocrine cells. |
|
|
Immunohistochemical staining of human kidney (renal cancer) shows moderate immunoreactivity in cancer cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human RT-4 cell line |
|
|
AMAb90639 |
|
|
|
|
|
AMAb90639 |
|
|
AMAb90639 |
Product Guarantee and Expert Support
