Anti-ATRX, IgG1, Clone: [CL0537], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90784
- Images (15)
| Article Name: | Anti-ATRX, IgG1, Clone: [CL0537], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90784 |
| Supplier Catalog Number: | AMAb90784 |
| Alternative Catalog Number: | ATA-AMAB90784-100,ATA-AMAB90784-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | JMS, RAD54, XH2, XNP |
| alpha thalassemia/mental retardation syndrome X-linked |
| Anti-ATRX |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0537] |
| Isotype: | IgG1 |
| NCBI: | 546 |
| UniProt: | P46100 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATRX |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunofluorescence staining in HeLa cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in A431 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in MCF7 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in U251 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunohistochemical staining of human glioma shows strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells. |
|
|
Staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line A-549. |
|
|
AMAb90784 |
|
|
|
|
|
|
|
|
AMAb90784 |
|
|
AMAb90784 |
Product Guarantee and Expert Support
