Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90806
- Images (8)
| Article Name: | Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90806 |
| Supplier Catalog Number: | AMAb90806 |
| Alternative Catalog Number: | ATA-AMAB90806-100,ATA-AMAB90806-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLG4B, Pan-Cancer |
| matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
| Anti-MMP9 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0542] |
| Isotype: | IgG2b |
| NCBI: | 4318 |
| UniProt: | P14780 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MMP9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human lung shows strong immunoreactivity in the macrophages and granulocytes. |
|
|
Immunohistochemical staining of human spleen shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows strong immunoreactivity in granulocytes. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human uterus shows absence of immunoreactivity (negative control). |
|
|
AMAb90806 |
|
|
AMAb90806 |
|
|
AMAb90806 |
Product Guarantee and Expert Support
