Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90816
- Images (8)
| Article Name: | Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90816 |
| Supplier Catalog Number: | AMAb90816 |
| Alternative Catalog Number: | ATA-AMAB90816-100,ATA-AMAB90816-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ERBB, ERBB1, Pan-Cancer |
| epidermal growth factor receptor |
| Anti-EGFR |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0815] |
| Isotype: | IgG1 |
| NCBI: | 1956 |
| UniProt: | P00533 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EGFR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows moderate membranous immunoreactivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblast. |
|
|
Immunohistochemical staining of human ventricular cancer shows moderate membranous immunoreactivity in tumor cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line A-431 |
|
|
|
|
|
AMAb90816 |
|
|
AMAb90816 |
|
|
AMAb90816 |
Product Guarantee and Expert Support
