Anti-THY1, IgG2b, Clone: [CL1028], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90844
- Images (8)
| Article Name: | Anti-THY1, IgG2b, Clone: [CL1028], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90844 |
| Supplier Catalog Number: | AMAb90844 |
| Alternative Catalog Number: | ATA-AMAB90844-100,ATA-AMAB90844-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD90, Pan-Cancer |
| Thy-1 cell surface antigen |
| Anti-THY1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1028] |
| Isotype: | IgG2b |
| NCBI: | 7070 |
| UniProt: | P04216 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | THY1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in the molecular layer. |
|
|
Immunohistochemical staining of human testis shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human cerebral cortex |
|
|
AMAb90844 |
|
|
|
|
|
AMAb90844 |
|
|
AMAb90844 |
Product Guarantee and Expert Support
