Anti-RHOT1, IgG1, Clone: [CL1083], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90852
- Images (9)
| Article Name: | Anti-RHOT1, IgG1, Clone: [CL1083], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90852 |
| Supplier Catalog Number: | AMAb90852 |
| Alternative Catalog Number: | ATA-AMAB90852-100,ATA-AMAB90852-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARHT1, FLJ11040, MIRO-1 |
| ras homolog family member T1 |
| Anti-RHOT1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1083] |
| Isotype: | IgG1 |
| NCBI: | 55288 |
| UniProt: | Q8IXI2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RHOT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells, as well as positivity in neuropil. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in striated muscle fibers. |
|
|
Western blot analysis in human cerebral cortex tissue. |
|
|
AMAb90852 |
|
|
|
|
|
AMAb90852 |
|
|
AMAb90852 |
Product Guarantee and Expert Support
