Anti-MCL1, IgG1, Clone: [CL1128], Mouse, Monoclonal

Product Overview

• Article Name: Anti-MCL1, IgG1, Clone: [CL1128], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90859
• Supplier Catalog Number: AMAb90859
• Alternative Catalog Number: ATA-AMAB90859-100,ATA-AMAB90859-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BCL2L3, Mcl-1, Pan-Cancer

Product Description

myeloid cell leukemia sequence 1 (BCL2-related)

Additional Information

Anti-MCL1

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL1128]
• Isotype: IgG1
• NCBI: 4170
• UniProt: Q07820
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MCL1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml

Images

Immunohistochemical staining of human tonsil shows strong immunoreactivity in the reaction centrum.

Immunohistochemical staining of human breast cancer shows strong positivity in tumor cells.

Immunohistochemical staining of stomach cancer shows cytoplasmic immunoreactivity in tumor cells.

Immunohistochemical staining of lymph node in human colon shows strong positivity in the reaction centrum.

Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate) 
Lane 3: MCL1 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411855)

AMAb90859

AMAb90859

AMAb90859