Anti-CDH1, IgG2b, Clone: [CL1170], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90862
- Images (11)
| Article Name: | Anti-CDH1, IgG2b, Clone: [CL1170], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90862 |
| Supplier Catalog Number: | AMAb90862 |
| Alternative Catalog Number: | ATA-AMAB90862-100,ATA-AMAB90862-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD324, UVO, uvomorulin, Pan-Cancer |
| cadherin 1, type 1, E-cadherin (epithelial) |
| Anti-CDH1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1170] |
| Isotype: | IgG2b |
| NCBI: | 999 |
| UniProt: | P12830 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using AMAb90862 antibody. Corresponding CDH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human colorectal cancer shows moderate to strong membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
AMAb90862 |
|
|
|
|
|
|
|
|
AMAb90862 |
|
|
AMAb90862 |
Product Guarantee and Expert Support
