Anti-ERCC1, IgG2a, Clone: [CL1249], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90871
- Images (11)
| Article Name: | Anti-ERCC1, IgG2a, Clone: [CL1249], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90871 |
| Supplier Catalog Number: | AMAb90871 |
| Alternative Catalog Number: | ATA-AMAB90871-100,ATA-AMAB90871-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RAD10, Pan-Cancer |
| excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) |
| Anti-ERCC1 |
| Clonality: | Monoclonal |
| Concentration: | 0.5 |
| Clone Designation: | [CL1249] |
| Isotype: | IgG2a |
| NCBI: | 2067 |
| UniProt: | P07992 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ERCC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human stomach cancer shows strong nuclear immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human liver cancer shows strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human breast cancer shows strong nuclear immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human prostate cancer shows strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human testis shows strong nuclear immunoreactivity in germinal cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows nuclear immunoreactivity both in glandular and lymphoid cells. |
|
|
AMAb90871 |
|
|
|
|
|
AMAb90871 |
|
|
AMAb90871 |
Product Guarantee and Expert Support
