Anti-ERCC1, IgG1, Clone: [CL1284], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90872
- Images (11)
| Article Name: | Anti-ERCC1, IgG1, Clone: [CL1284], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90872 |
| Supplier Catalog Number: | AMAb90872 |
| Alternative Catalog Number: | ATA-AMAB90872-100,ATA-AMAB90872-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RAD10, Pan-Cancer |
| excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) |
| Anti-ERCC1 |
| Clonality: | Monoclonal |
| Concentration: | 0.7 |
| Clone Designation: | [CL1284] |
| Isotype: | IgG1 |
| NCBI: | 2067 |
| UniProt: | P07992 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ERCC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human colorectal cancer shows strong nuclear immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human ventricular cancer shows strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human prostate cancer shows strong nuclear immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in seminiferous tubules. |
|
|
Immunohistochemical staining of human colon shows nuclear immunoreactivity in both glandular and lymphoid cells. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ERCC1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line RT-4 |
|
|
AMAb90872 |
|
|
|
|
|
AMAb90872 |
|
|
AMAb90872 |
Product Guarantee and Expert Support
