Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90873
- Images (7)
| Article Name: | Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90873 |
| Supplier Catalog Number: | AMAb90873 |
| Alternative Catalog Number: | ATA-AMAB90873-100,ATA-AMAB90873-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1, Pan-Cancer |
| CD68 molecule |
| Anti-CD68 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1338] |
| Isotype: | IgG1 |
| NCBI: | 968 |
| UniProt: | P34810 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD68 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells. |
|
|
Immunohistochemical staining of human colon shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil shows strong immunoreactivity in single cells. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
AMAb90873 |
|
|
AMAb90873 |
|
|
AMAb90873 |
Product Guarantee and Expert Support
