Anti-CD68, IgG1, Clone: [CL1346], Mouse, Monoclonal

Product Overview

• Article Name: Anti-CD68, IgG1, Clone: [CL1346], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90874
• Supplier Catalog Number: AMAb90874
• Alternative Catalog Number: ATA-AMAB90874-100,ATA-AMAB90874-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1, Pan-Cancer

Product Description

CD68 molecule

Additional Information

Anti-CD68

Product Properties

• Clonality: Monoclonal
• Concentration: 0.1
• Clone Designation: [CL1346]
• Isotype: IgG1
• NCBI: 968
• UniProt: P34810
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CD68
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500, WB: 1 µg/ml

Images

Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells.

Immunohistochemical staining of human liver shows strong positivity in Kupffer cells.

Immunohistochemical staining of human colon shows strong immunoreactivity in a subset of lymphoid cells.

Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).

Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CD68 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Lane 1: Marker [kDa]
Lane 2: Human spleen tissue lysate

AMAb90874

AMAb90874

AMAb90874