Anti-CD3E, IgG1, Clone: [CL1466], Mouse, Monoclonal

Product Overview

• Article Name: Anti-CD3E, IgG1, Clone: [CL1466], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90876
• Supplier Catalog Number: AMAb90876
• Alternative Catalog Number: ATA-AMAB90876-100,ATA-AMAB90876-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

CD3e molecule, epsilon (CD3-TCR complex)

Additional Information

Anti-CD3E

Product Properties

• Clonality: Monoclonal
• Concentration: 0.1
• Clone Designation: [CL1466]
• Isotype: IgG1
• NCBI: 916
• UniProt: P07766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CD3E
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500, WB: 1 µg/ml

Images

Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using AMAb90876 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human tonsil shows strong membranous positivity, mainly in in non - germinal center cells.

Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphoid cells.

Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in lymphoid cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate

AMAb90876

AMAb90876

AMAb90876