Anti-CD8A, IgG1, Clone: [CL1529], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90883
- Images (8)
| Article Name: | Anti-CD8A, IgG1, Clone: [CL1529], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90883 |
| Supplier Catalog Number: | AMAb90883 |
| Alternative Catalog Number: | ATA-AMAB90883-100,ATA-AMAB90883-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD8, Pan-Cancer |
| CD8a molecule |
Anti-CD8A
|
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1529] |
| Isotype: | IgG1 |
| NCBI: | 925 |
| UniProt: | P01732 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD8A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells outside the reaction centra. |
|
|
Immunohistochemical staining of human rectum shows strong positivity in a subset of lymphoid cells in lamina propria. |
|
|
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells in lamina propria. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
AMAb90883 |
|
|
AMAb90883 |
|
|
AMAb90883 |
Product Guarantee and Expert Support
