Anti-CD14, IgG1, Clone: [CL1638], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90898
- Images (8)
| Article Name: | Anti-CD14, IgG1, Clone: [CL1638], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90898 |
| Supplier Catalog Number: | AMAb90898 |
| Alternative Catalog Number: | ATA-AMAB90898-100,ATA-AMAB90898-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| CD14 molecule |
| Anti-CD14 |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL1638] |
| Isotype: | IgG1 |
| NCBI: | 929 |
| UniProt: | D6RFL4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human liver and pancreas tissues using AMAb90898 antibody. Corresponding CD14 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in Kupffer cells. |
|
|
Immunohistochemical staining of human tonsil shows moderate membranous positivity, mainly in germinal center cells. |
|
|
Immunohistochemical staining of human rectum shows moderate membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
AMAb90898 |
|
|
AMAb90898 |
|
|
AMAb90898 |
Product Guarantee and Expert Support
