Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal

Product Overview

• Article Name: Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90901
• Supplier Catalog Number: AMAb90901
• Alternative Catalog Number: ATA-AMAB90901-100,ATA-AMAB90901-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C-Kit, CD117, PBT, SCFR, Pan-Cancer

Product Description

v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog

Additional Information

Anti-KIT

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL1657]
• Isotype: IgG1
• NCBI: 3815
• UniProt: P10721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KIT
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 1 µg/ml

Images

Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells (macrophages).

Immunohistochemical staining of human stomach shows strong positivity in a subset of lymphoid cells.

Immunohistochemical staining of human colon shows strong immunoreactivity in a subset of lymphoid cells.

Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil of the molecular layer.

Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4

AMAb90901

AMAb90901

AMAb90901