Anti-KIT, IgG2a, Clone: [CL1667], Mouse, Monoclonal

Product Overview

• Article Name: Anti-KIT, IgG2a, Clone: [CL1667], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90904
• Supplier Catalog Number: AMAb90904
• Alternative Catalog Number: ATA-AMAB90904-100,ATA-AMAB90904-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C-Kit, CD117, PBT, SCFR, Pan-Cancer

Product Description

v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog

Additional Information

Anti-KIT

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL1667]
• Isotype: IgG2a
• NCBI: 3815
• UniProt: P10721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KIT
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells.

Immunohistochemical staining of human tonsil shows strong positivity in a subset of lymphoid cells.

Immunohistochemical staining of human colon shows strong immunoreactivity in some lymphoid cells.

Immunohistochemical staining of human cerebellum shows moderate positivity in the molecular layer.

Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4

AMAb90904

AMAb90904

AMAb90904