Anti-ATF3, IgG1, Clone: [CL1685], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90909
- Images (9)
| Article Name: | Anti-ATF3, IgG1, Clone: [CL1685], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90909 |
| Supplier Catalog Number: | AMAb90909 |
| Alternative Catalog Number: | ATA-AMAB90909-100,ATA-AMAB90909-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ATF3 |
| activating transcription factor 3 |
| Anti-ATF3 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1685] |
| Isotype: | IgG1 |
| NCBI: | 467 |
| UniProt: | P18847 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATF3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90909 antibody. Corresponding ATF3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach cancer shows moderate to strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
AMAb90909 |
|
|
|
|
|
AMAb90909 |
|
|
AMAb90909 |
Product Guarantee and Expert Support
