Anti-ITIH4, IgG1, Clone: [CL1858], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90921
- Images (9)
| Article Name: | Anti-ITIH4, IgG1, Clone: [CL1858], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90921 |
| Supplier Catalog Number: | AMAb90921 |
| Alternative Catalog Number: | ATA-AMAB90921-100,ATA-AMAB90921-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | H4P, IHRP, ITIHL1 |
| inter-alpha-trypsin inhibitor heavy chain family, member 4 |
| Anti-ITIH4 |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL1858] |
| Isotype: | IgG1 |
| NCBI: | 3700 |
| UniProt: | Q14624 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITIH4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human liver shows immunoreactivity in sinusoids. |
|
|
Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in blood vessels and in plasma. |
|
|
Immunohistochemical staining of human kidney (renal cancer) shows strong positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human liver tissue lysate |
|
|
AMAb90921 |
|
|
|
|
|
AMAb90921 |
|
|
AMAb90921 |
Product Guarantee and Expert Support
