Anti-ENG, IgG1, Clone: [CL1912], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90925
- Images (9)
| Article Name: | Anti-ENG, IgG1, Clone: [CL1912], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90925 |
| Supplier Catalog Number: | AMAb90925 |
| Alternative Catalog Number: | ATA-AMAB90925-100,ATA-AMAB90925-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD105, END, HHT1, ORW, ORW1, Pan-Cancer |
| endoglin |
| Anti-ENG |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL1912] |
| Isotype: | IgG1 |
| NCBI: | 2022 |
| UniProt: | P17813 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ENG |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human renal cancer shows strong immunoreactivity in the blood vessels. |
|
|
Immunohistochemical staining of human liver cancer shows positivity in the sinusoids. |
|
|
Immunohistochemical staining of human stomach cancer shows strong immunoreactivity in the blood vessels walls. |
|
|
Immunohistochemical staining of human colon shows moderate positivity in the endothelium of blood vessels. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the blood vessels. |
|
|
Immunohistochemical staining of smooth muscle shows absence of positivity in myocytes (negative control). |
|
|
AMAb90925 |
|
|
AMAb90925 |
|
|
AMAb90925 |
Product Guarantee and Expert Support
