Anti-VWF, IgG1, Clone: [CL1957], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90931
- Images (10)
| Article Name: | Anti-VWF, IgG1, Clone: [CL1957], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90931 |
| Supplier Catalog Number: | AMAb90931 |
| Alternative Catalog Number: | ATA-AMAB90931-100,ATA-AMAB90931-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | F8VWF, Pan-Cancer |
| von Willebrand factor |
| Anti-VWF |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1957] |
| Isotype: | IgG1 |
| NCBI: | 7450 |
| UniProt: | P04275 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VWF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human rectum shows strong immunoreactivity in a blood vessel. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in blood vessels. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in blood vessels. |
|
|
Immunohistochemical staining of human testis shows strong positivity in larger and smaller blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human spleen tissue lysate |
|
|
AMAb90931 |
|
|
|
|
|
AMAb90931 |
|
|
AMAb90931 |
Product Guarantee and Expert Support
