Anti-p53, IgG1, Clone: [CL2199], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90956
- Images (16)
| Article Name: | Anti-p53, IgG1, Clone: [CL2199], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90956 |
| Supplier Catalog Number: | AMAb90956 |
| Alternative Catalog Number: | ATA-AMAB90956-100,ATA-AMAB90956-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TP53, LFS1, Pan-Cancer |
| tumor protein p53 |
| Anti-p53 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2199] |
| Isotype: | IgG1 |
| NCBI: | 7157 |
| UniProt: | P04637 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TP53 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunofluorescence staining in A431 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in MCF7 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in U2OS cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunofluorescence staining in U251 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using AMAb90956 antibody. Corresponding p53 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colorectal cancer shows strong nuclear positivity in tumor cells, but not in normal mucosa. |
|
|
Immunohistochemical staining of human lung cancer (squamous cell carcinoma) shows strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in a subset of epidermal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-p53 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 |
|
|
AMAb90956 |
|
|
|
|
|
|
|
|
AMAb90956 |
|
|
AMAb90956 |
Product Guarantee and Expert Support
