Anti-PARP1, IgG1, Clone: [CL2209], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90960
- Images (11)
| Article Name: | Anti-PARP1, IgG1, Clone: [CL2209], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90960 |
| Supplier Catalog Number: | AMAb90960 |
| Alternative Catalog Number: | ATA-AMAB90960-100,ATA-AMAB90960-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADPRT, PARP, PPOL, Pan-Cancer |
| poly (ADP-ribose) polymerase 1 |
| Anti-PARP1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2209] |
| Isotype: | IgG1 |
| NCBI: | 142 |
| UniProt: | P09874 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PARP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong nuclear immunoreactivity in both epidermis and dermis. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in granular and molecular layer cells, as well as in Purkinje cells. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast. |
|
|
Immunohistochemical staining of human kidney shows nuclear positivity in both tubuli and glomeruli. |
|
|
Immunohistochemical staining of human liver shows nuclear immunoreactivity in hepatocytes. |
|
|
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line RT-4 |
|
|
AMAb90960 |
|
|
|
|
|
AMAb90960 |
|
|
AMAb90960 |
Product Guarantee and Expert Support
