Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91057
Article Name: |
Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal |
Biozol Catalog Number: |
ATA-AMAB91057 |
Supplier Catalog Number: |
AMAb91057 |
Alternative Catalog Number: |
ATA-AMAB91057-100,ATA-AMAB91057-25 |
Manufacturer: |
Atlas Antibodies |
Host: |
Mouse |
Category: |
Antikörper |
Application: |
IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
CA125, Pan-Cancer |
mucin 16, cell surface associated |
Clonality: |
Monoclonal |
Concentration: |
1 |
Clone Designation: |
[CL2783] |
Isotype: |
IgG2b |
NCBI: |
94025 |
UniProt: |
Q8WXI7 |
Buffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Protein A purified |
Sequence: |
GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
MUC16 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
IHC: 1:500 - 1:1000 |
|
Immunohistochemical staining of human endometrium shows strong immunoreactivity in apical membranes of glandular cells. |
|
Immunohistochemical staining of human fallopian tube shows positivity in ciliated glandular cells. |
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity as expected (negative control). |
|
AMAb91057 |
|
AMAb91057 |
|
AMAb91057 |