Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91057
- Images (6)
| Article Name: | Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91057 |
| Supplier Catalog Number: | AMAb91057 |
| Alternative Catalog Number: | ATA-AMAB91057-100,ATA-AMAB91057-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CA125, Pan-Cancer |
| mucin 16, cell surface associated |
| Anti-MUC16 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2783] |
| Isotype: | IgG2b |
| NCBI: | 94025 |
| UniProt: | Q8WXI7 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MUC16 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human endometrium shows strong immunoreactivity in apical membranes of glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows positivity in ciliated glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity as expected (negative control). |
|
|
AMAb91057 |
|
|
AMAb91057 |
|
|
AMAb91057 |
Product Guarantee and Expert Support
