Anti-LAMA2, IgG1, Clone: [CL3450], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91166
- Images (13)
| Article Name: | Anti-LAMA2, IgG1, Clone: [CL3450], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91166 |
| Supplier Catalog Number: | AMAb91166 |
| Alternative Catalog Number: | ATA-AMAB91166-100,ATA-AMAB91166-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LAMM |
| laminin, alpha 2 |
| Anti-LAMA2 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3450] |
| Isotype: | IgG1 |
| NCBI: | 3908 |
| UniProt: | P24043 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LAMA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and tonsil tissues using AMAb91166 antibody. Corresponding LAMA2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in basement membrane of trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemical staining of rat heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of rat stomach shows strong positivity in basement membrane of glandular cells. |
|
|
Immunohistochemical staining of mouse heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Western blot analysis of purified human recombinant Laminin-211, Laminin-221, Laminin-332, Laminin-421, Laminin-511 and Laminin-121. |
|
|
AMAb91166 |
|
|
|
|
|
AMAb91166 |
|
|
AMAb91166 |
Product Guarantee and Expert Support
