Anti-PDCD1, IgG1, Clone: [CL3624], Mouse, Monoclonal

Product Overview

• Article Name: Anti-PDCD1, IgG1, Clone: [CL3624], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91197
• Supplier Catalog Number: AMAb91197
• Alternative Catalog Number: ATA-AMAB91197-100,ATA-AMAB91197-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD279, hSLE1, PD1, SLEB2, Pan-Cancer

Product Description

programmed cell death 1

Additional Information

Anti-PDCD1

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL3624]
• Isotype: IgG1
• NCBI: 5133
• UniProt: Q15116
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PDCD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, mainly in the reaction centrum.

Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401555)

AMAb91197

AMAb91197

AMAb91197