Anti-CTNNB1, IgG1, Clone: [CL3691], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91210
- Images (16)
| Article Name: | Anti-CTNNB1, IgG1, Clone: [CL3691], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91210 |
| Supplier Catalog Number: | AMAb91210 |
| Alternative Catalog Number: | ATA-AMAB91210-100,ATA-AMAB91210-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | armadillo, beta-catenin, CTNNB, Pan-Cancer |
| catenin (cadherin-associated protein), beta 1, 88kDa |
| Anti-CTNNB1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3691] |
| Isotype: | IgG1 |
| NCBI: | 1499 |
| UniProt: | P35222 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CTNNB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:10000 - 1:20000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows strong membranous immunoreactivity in the epithelial cells. |
|
|
Immunohistochemical staining of human cervix shows strong membranous positivity in epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows membranous immunoreactivity in epithelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous immunoreactivity in epithelial cells. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblast. |
|
|
Immunohistochemical staining of human prostate cancer shows membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human breast cancer shows membranous immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity in muscle fibers (negative control). |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line SK-MEL-30 |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line A-549 |
|
|
|
|
|
|
|
|
AMAb91210 |
|
|
AMAb91210 |
|
|
AMAb91210 |
Product Guarantee and Expert Support
