Anti-TP63, IgG1, Clone: [CL3748], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91224
- Images (11)
| Article Name: | Anti-TP63, IgG1, Clone: [CL3748], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91224 |
| Supplier Catalog Number: | AMAb91224 |
| Alternative Catalog Number: | ATA-AMAB91224-100,ATA-AMAB91224-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L, Pan-Cancer |
| tumor protein p63 |
| Anti-TP63 |
| Clonality: | Monoclonal |
| Concentration: | 0.7 |
| Clone Designation: | [CL3748] |
| Isotype: | IgG1 |
| NCBI: | 8626 |
| UniProt: | Q9H3D4 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TP63 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human prostate cancer shows absence of nuclear immunoreactivity in tumor cells, while it is present in the adjacent normal a basal epithelial cells. |
|
|
Immunohistochemical staining of human cervix shows strong nuclear immunoreactivity in epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows nuclear immunoreactivity in basal epithelial cells. |
|
|
Immunohistochemical staining of human placenta shows nuclear positivity in a subset of cells. |
|
|
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control). |
|
|
Immunohistochemical staining of human lung cancer (adenocarcinoma) shows absence of immunoreactivity (negative control). |
|
|
Western blot analysis in human cell line RT-4. |
|
|
AMAb91224 |
|
|
|
|
|
AMAb91224 |
|
|
AMAb91224 |
Product Guarantee and Expert Support
