Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal

Catalog Number: ATA-AMAB91257
Article Name: Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB91257
Supplier Catalog Number: AMAb91257
Alternative Catalog Number: ATA-AMAB91257-100,ATA-AMAB91257-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BRAF1, RAFB1, Pan-Cancer
B-Raf proto-oncogene, serine/threonine kinase
Anti-BRAF
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL4003]
Isotype: IgG1
NCBI: 673
UniProt: P15056
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BRAF
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells.
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells.
Western blot analysis in human cell line MOLT-4.
AMAb91257
AMAb91257
AMAb91257