Anti-BRAF Antibody 100ul, IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB91258
Article Name: Anti-BRAF Antibody 100ul, IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB91258
Supplier Catalog Number: AMAb91258
Alternative Catalog Number: ATA-AMAB91258-100,ATA-AMAB91258-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BRAF1, RAFB1
B-Raf proto-oncogene, serine/threonine kinase
Anti-BRAF
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL4004]
Isotype: IgG2b
NCBI: 673
UniProt: P15056
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BRAF
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells.
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules.
Western blot analysis in human cell line MOLT-4.
AMAb91258
AMAb91258
AMAb91258