Anti-BRAF, IgG2b, Clone: [CL4004], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91258
Article Name: |
Anti-BRAF, IgG2b, Clone: [CL4004], Mouse, Monoclonal |
Biozol Catalog Number: |
ATA-AMAB91258 |
Supplier Catalog Number: |
AMAb91258 |
Alternative Catalog Number: |
ATA-AMAB91258-100,ATA-AMAB91258-25 |
Manufacturer: |
Atlas Antibodies |
Host: |
Mouse |
Category: |
Antikörper |
Application: |
IHC, WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
BRAF1, RAFB1, Pan-Cancer |
B-Raf proto-oncogene, serine/threonine kinase |
Clonality: |
Monoclonal |
Concentration: |
1 |
Clone Designation: |
[CL4004] |
Isotype: |
IgG2b |
NCBI: |
673 |
UniProt: |
P15056 |
Buffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Protein A purified |
Sequence: |
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
BRAF |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules. |
|
Western blot analysis in human cell line MOLT-4. |
|
AMAb91258 |
|
|
|
AMAb91258 |
|
AMAb91258 |