Anti-SMCHD1, IgG2b, Clone: [CL4270], Mouse, Monoclonal

Product Overview

• Article Name: Anti-SMCHD1, IgG2b, Clone: [CL4270], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91282
• Supplier Catalog Number: AMAb91282
• Alternative Catalog Number: ATA-AMAB91282-100,ATA-AMAB91282-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0650

Product Description

structural maintenance of chromosomes flexible hinge domain containing 1

Additional Information

Anti-SMCHD1

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL4270]
• Isotype: IgG2b
• NCBI: 23347
• UniProt: A6NHR9
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SMCHD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells.

Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast.

Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells.

Immunohistochemical staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells.

Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control).

AMAb91282

AMAb91282

AMAb91282