Anti-PRAME, IgG2a, Clone: [CL5146], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91329
| Article Name: |
Anti-PRAME, IgG2a, Clone: [CL5146], Mouse, Monoclonal |
| Biozol Catalog Number: |
ATA-AMAB91329 |
| Supplier Catalog Number: |
AMAb91329 |
| Alternative Catalog Number: |
ATA-AMAB91329-100,ATA-AMAB91329-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Mouse |
| Category: |
Antikörper |
| Application: |
ICC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CT130, MAPE, Pan-Cancer |
| preferentially expressed antigen in melanoma |
| Clonality: |
Monoclonal |
| Concentration: |
1 |
| Clone Designation: |
[CL5146] |
| Isotype: |
IgG2a |
| NCBI: |
23532 |
| UniProt: |
P78395 |
| Buffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Protein A purified |
| Sequence: |
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
PRAME |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 2-10 µg/ml, WB: 1 µg/ml |
![]()
|
Western blot analysis in human cell line U-2 OS. |
![]()
|
AMAb91329 |
![]()
|
AMAb91329 |
