Anti-PRAME, IgG1, Clone: [CL5148], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91330
- Images (8)
| Article Name: | Anti-PRAME, IgG1, Clone: [CL5148], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91330 |
| Supplier Catalog Number: | AMAb91330 |
| Alternative Catalog Number: | ATA-AMAB91330-100,ATA-AMAB91330-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT130, MAPE, Pan-Cancer |
| preferentially expressed antigen in melanoma |
| Anti-PRAME |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL5148] |
| Isotype: | IgG1 |
| NCBI: | 23532 |
| UniProt: | P78395 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRAME |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:250 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear immunoreactivity in a subset of cells in seminiferous tubules. |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cervix shows absence of positivity as expected (negative control). |
|
|
Western blot analysis in human cell line U-2 OS. |
|
|
AMAb91330 |
|
|
|
|
|
AMAb91330 |
|
|
AMAb91330 |
Product Guarantee and Expert Support
