Anti-CUX1, IgG2b, Clone: [CL5275], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91352
- Images (9)
| Article Name: | Anti-CUX1, IgG2b, Clone: [CL5275], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91352 |
| Supplier Catalog Number: | AMAb91352 |
| Alternative Catalog Number: | ATA-AMAB91352-100,ATA-AMAB91352-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CUTL1 |
| cut-like homeobox 1 |
| Anti-CUX1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL5275] |
| Isotype: | IgG2b |
| NCBI: | 1523 |
| UniProt: | P39880 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CUX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:1000-1:2500 |
|
|
Immunofluorescence staining of WM-115 cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Immunofluorescence staining of SH-SY5Y cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear immunoreactivity in neuronal cells in granular, molecular and Purkinje cells layers. |
|
|
Immunohistochemical staining of human endometrium shows nuclear immunoreactivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells. |
|
|
AMAb91352 |
|
|
|
|
|
AMAb91352 |
|
|
AMAb91352 |
Product Guarantee and Expert Support
