Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal

Product Overview

• Article Name: Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91366
• Supplier Catalog Number: AMAb91366
• Alternative Catalog Number: ATA-AMAB91366-100,ATA-AMAB91366-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CCN2, IGFBP8, Pan-Cancer

Product Description

connective tissue growth factor

Additional Information

Anti-CTGF

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL5339]
• Isotype: IgG1
• NCBI: 1490
• UniProt: P29279
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CTGF
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemical staining of mouse brain shows cytoplasmic immunoreactivity in cortical layer 6b neurons.

Immunohistochemical staining of mouse cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.

Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.

Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in neurons in layer 6b.

Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in layer 6 neurons.

Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid cells as expected (negative control).

Western blot analysis in human cell line U-251 MG.

AMAb91366

AMAb91366

AMAb91366