Anti-ITGA5, IgG2b, Clone: [CL6951], Mouse, Monoclonal

Product Overview

• Article Name: Anti-ITGA5, IgG2b, Clone: [CL6951], Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91449
• Supplier Catalog Number: AMAb91449
• Alternative Catalog Number: ATA-AMAB91449-100,ATA-AMAB91449-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD49e, FNRA, Pan-Cancer

Product Description

integrin subunit alpha 5

Additional Information

Anti-ITGA5

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL6951]
• Isotype: IgG2b
• NCBI: 3678
• UniProt: P08648
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ITGA5
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:10000 - 1:20000, WB: 1 µg/ml

Images

Immunohistochemistry analysis in human placenta and skeletal muscle tissues using AMAb91449 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human placenta shows strong positivity in apical membranes of trophoblastic cells.

Immunohistochemical staining of human prostate shows strong membranous positivity in smooth muscle cells.

Immunohistochemical staining of human liver shows strong positivity in liver sinusoids.

Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Western blot analysis in human cell line U-87 MG.

AMAb91449

AMAb91449

AMAb91449